Seek Communing Access to

hybrideringwateweringcliffingpeakeringwampingforesthingnativingnurvivingnaturingtreewardingvuntingslothingweastingplettingwaterfallinggroundingtriveringlardeningislandingsarmingnighttingcishingcavingwildgingminimalingsunninghilloringgerdingalterlingherbivinginsectinginsevingnaturalingnearningporestingseedvingsounscapingenerginggeatingwatevingnarifyingnatifulingnietingimmuninggroodingorchingsoileringnastingoceaningreneratingneachingbirdering weCommunes

We are a generational commune for ecological life. Redefine our way of life.

Excited already? Join the Alpha Generation.

sarming

April 5, 2021

cishing

April 5, 2021

cavoring

April 5, 2021

renerating

April 5, 2021

alterling

March 12, 2021

hybridering

March 12, 2021

watewering

March 12, 2021

cliffing

March 12, 2021

hilloring

March 8, 2021

peakering

March 8, 2021

sunning

March 8, 2021

wamping

March 8, 2021

gerding

March 8, 2021

herbiving

March 8, 2021

insecting

March 8, 2021

inseving

March 8, 2021

foresthing

March 8, 2021

nativing

March 8, 2021

naturaling

March 8, 2021

naturing

March 8, 2021

nearning

March 8, 2021

nurviving

March 8, 2021

poresting

March 8, 2021

seedving

March 8, 2021

sounscaping

March 8, 2021

treewarding

March 8, 2021

vunting

March 8, 2021

weasting

March 8, 2021

energing

March 5, 2021

geating

March 5, 2021

wateving

March 5, 2021

minimaling

March 5, 2021

narifying

March 5, 2021

natifuling

March 5, 2021

nighting

March 5, 2021

nieting

March 5, 2021

immuning

March 5, 2021

slothing

March 5, 2021

grooding

March 5, 2021

grounding

March 5, 2021

orching

March 5, 2021

pletting

March 5, 2021

soilering

March 5, 2021

wildging

March 5, 2021

islanding

March 5, 2021

lardening

March 5, 2021

birdering

March 5, 2021

nasting

March 5, 2021

oceaning

March 5, 2021

trivering

March 5, 2021

waterfalling

March 5, 2021

neaching

March 5, 2021

What exactly is weCommunes?

weCommunes are generational ecological events for ecological therapy to accelerate mass ecological transition and mass conservation. Currently, there are 52 weCommunes (neologism-derived) to define active Ecocitizenship and Earth Stewardship, embracing the Ecological Age.

How do I gain communing access to any weCommunes?

Firstly, you must be a Communer of weNATUREearth to gain communing access to the weCommunes. Through the hybrid of both web-based and mobile application (weNATUREapp), Communers can manage and personalise their communing access.

How do I activate weNATUREapp?

All Communers of weNATUREearth will be given a decentralised blockchain-based ecological domain to gain access to the weNATUREapp, a hybrid digital platform. weNATUREapp (beta version) will be released during the Beta Catapult and will be ready during the Prime Debut.

How do I earn weCommunes’ Bamboo Medals?

All Communers of weNATUREearth are entitled to the indigenous-crafted biodegradable Bamboo Medals whenever they participate in weCommunes subject to specific eligibility requirements. Each Bamboo Medal will indicate the Communers’ name and weCommunes’ participation details.

Is it available in my country?

All intentional and conscious humans are welcome to seek communeship with weNATUREearth. At present time, until the prime debut, weNATUREearth will focus its impacts and footprints in 38 regions across the Southeast Asia and the Austronesian world. Next, we will expand to the South America and the Amazonian world by 2030, and subsequently to the South Africa and the Congolian world by 2035. weNATUREearth’s communeship will spread out throughout the tropics.

Restrictions (Age under 21)

For safety and security purposes, 26 weCommunes are strictly restricted to Communers age 21 years old and above. Certain outdoor activities are risky and dangerous.

ikatanPertiwi Availability

ikatanPertiwi ceremony is a lifetime momentous event to demonstrate ecological consciousness, for Communers age 21 years old and above. Only 6 weCommunes has ikatanPertiwi ceremony namely the Hilloring, Wamping, Nativing, Nearning, Islanding, and Waterfalling.