Seek Communing Access to
hybrideringwateweringcliffingpeakeringwampingforesthingnativingnurvivingnaturingtreewardingvuntingslothingweastingplettingwaterfallinggroundingtriveringlardeningislandingsarmingnighttingcishingcavingwildgingminimalingsunninghilloringgerdingalterlingherbivinginsectinginsevingnaturalingnearningporestingseedvingsounscapingenerginggeatingwatevingnarifyingnatifulingnietingimmuninggroodingorchingsoileringnastingoceaningreneratingneachingbirdering weCommunes
Excited already? Join the Alpha Generation.
What exactly is weCommunes?
weCommunes are generational ecological events for ecological therapy to accelerate mass ecological transition and mass conservation. Currently, there are 52 weCommunes (neologism-derived) to define active Ecocitizenship and Earth Stewardship, embracing the Ecological Age.
How do I gain communing access to any weCommunes?
Firstly, you must be a Communer of WENATR to gain communing access to the weCommunes. Through the hybrid of both web-based and mobile application (WENATRapp), Communers can manage and personalise their communing access.
How do I activate WENATRapp?
All Communers of WENATR will be given a decentralised blockchain-based ecological domain to gain access to the WENATRapp, a hybrid digital platform. WENATRapp (beta version) will be released during the Beta Catapult and will be ready during the Prime Debut.
How do I earn weCommunes’ Bamboo Medals?
All Communers of WENATR are entitled to the indigenous-crafted biodegradable Bamboo Medals whenever they participate in weCommunes subject to specific eligibility requirements. Each Bamboo Medal will indicate the Communers’ name and weCommunes’ participation details.
Is it available in my country?
All intentional and conscious humans are welcome to seek communeship with WENATR. At present time, until the prime debut, WENATR will focus its impacts and footprints in 38 regions across the Southeast Asia and the Austronesian world. Next, we will expand to the South America and the Amazonian world by 2030, and subsequently to the South Africa and the Congolian world by 2035. WENATR’s communeship will spread out throughout the tropics.
Restrictions (Age under 21)
For safety and security purposes, 26 weCommunes are strictly restricted to Communers age 21 years old and above. Certain outdoor activities are risky and dangerous.
ikatanPertiwi Availability
ikatanPertiwi ceremony is a lifetime momentous event to demonstrate ecological consciousness, for Communers age 21 years old and above. Only 6 weCommunes has ikatanPertiwi ceremony namely the Hilloring, Wamping, Nativing, Nearning, Islanding, and Waterfalling.